Product Browser

Last updated: 2017/9/24

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CNTNAP4 (Human) Recombinant Protein (Q01)

  • Catalog # : H00085445-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CNTNAP4 partial ORF ( NP_207837, 1145 a.a. - 1244 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • VLGRILEHSDVDQETALAGAQGFTGCLSAVQLSHVAPLKAALHPSHPDPVTVTGHVTESSCMAQPGTDATSRERTHSFADHSGTIDDREPLANAIKSDSA
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00085445-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • CNTNAP4
  • Gene Alias:
  • CASPR4,KIAA1763
  • Gene Description:
  • contactin associated protein-like 4
  • Gene Summary:
  • This gene product belongs to the neurexin family, members of which function in the vertebrate nervous system as cell adhesion molecules and receptors. This protein, like other neurexin proteins, contains epidermal growth factor repeats and laminin G domains. In addition, it includes an F5/8 type C domain, discoidin/neuropilin- and fibrinogen-like domains, and thrombospondin N-terminal-like domains. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq
  • Other Designations:
  • cell recognition protein CASPR4
  • RSS
  • YouTube
  • Linkedin
  • Facebook