Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PRIC285 (Human) Recombinant Protein (Q01)

  • Catalog # : H00085441-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PRIC285 partial ORF ( NP_208384.2, 1973 a.a. - 2078 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • GVAVSSITKSQGSEWRYVLVSTVRTCAKSDLDQRPTKSWLKKFLGFVVDPNQVNVAVTRAQEGLCLIGDHLLLRCCPLWRSLLDFCEAQQTLVPAGQVRVCRRPTM
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.4
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00085441-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • PRIC285
  • Gene Alias:
  • FLJ00244,KIAA1769,MGC132634,MGC138228,PDIP-1
  • Gene Description:
  • peroxisomal proliferator-activated receptor A interacting complex 285
  • Gene Summary:
  • The protein encoded by this gene is a nuclear transcriptional co-activator for peroxisome proliferator activated receptor alpha. The encoded protein contains a zinc finger and is a helicase that appears to be part of the peroxisome proliferator activated receptor alpha interacting complex. This gene is a member of the DNA2/NAM7 helicase gene family. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000031553,PPAR gamma DBD-interacting protein 1,PPAR-alpha interacting complex protein 285,PPARgamma-DNA-binding domain-interacting protein1,PRIC complex,peroxisomal proliferator-activated receptor alpha-interacting cofactor complex, 285 kD subuni
  • RSS
  • YouTube
  • Linkedin
  • Facebook