PRIC285 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PRIC285 partial ORF ( NP_208384.2, 1973 a.a. - 2078 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
GVAVSSITKSQGSEWRYVLVSTVRTCAKSDLDQRPTKSWLKKFLGFVVDPNQVNVAVTRAQEGLCLIGDHLLLRCCPLWRSLLDFCEAQQTLVPAGQVRVCRRPTM
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.4
Interspecies Antigen Sequence
Mouse (79)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PRIC285
Entrez GeneID
85441GeneBank Accession#
NM_033405Protein Accession#
NP_208384.2Gene Name
PRIC285
Gene Alias
FLJ00244, KIAA1769, MGC132634, MGC138228, PDIP-1
Gene Description
peroxisomal proliferator-activated receptor A interacting complex 285
Omim ID
611265Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a nuclear transcriptional co-activator for peroxisome proliferator activated receptor alpha. The encoded protein contains a zinc finger and is a helicase that appears to be part of the peroxisome proliferator activated receptor alpha interacting complex. This gene is a member of the DNA2/NAM7 helicase gene family. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000031553|PPAR gamma DBD-interacting protein 1|PPAR-alpha interacting complex protein 285|PPARgamma-DNA-binding domain-interacting protein1|PRIC complex|peroxisomal proliferator-activated receptor alpha-interacting cofactor complex, 285 kD subuni
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com