CCNB3 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CCNB3 expression in transfected 293T cell line (H00085417-T02) by CCNB3 MaxPab polyclonal antibody.
Lane 1: CCNB3 transfected lysate(12.20 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CCNB3 protein.
Immunogen
CCNB3 (ENSP00000365204, 1 a.a. ~ 111 a.a) full-length human protein.
Sequence
MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTKISPSSLQESPSSLQGALKKRSAFEDLTNASQCQPVQPKKEANKEFVKVVSKKINRNTHALGLAKKNKRNLK
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (47); Rat (44)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CCNB3 expression in transfected 293T cell line (H00085417-T02) by CCNB3 MaxPab polyclonal antibody.
Lane 1: CCNB3 transfected lysate(12.20 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CCNB3
Entrez GeneID
85417GeneBank Accession#
ENST00000376036Protein Accession#
ENSP00000365204Gene Name
CCNB3
Gene Alias
-
Gene Description
cyclin B3
Omim ID
300456Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. Studies of similar genes in chick and Drosophila suggest that this cyclin may associate with CDC2 and CDK2 kinases, and be required for proper spindle reorganization and restoration of the interphase nucleus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000023292|OTTHUMP00000023293
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com