EAF1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of EAF1 expression in transfected 293T cell line (H00085403-T01) by EAF1 MaxPab polyclonal antibody.
Lane 1: EAF1 transfected lysate(29.48 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to EAF1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to EAF1 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human EAF1 protein.
Immunogen
EAF1 (AAH41329.1, 1 a.a. ~ 268 a.a) full-length human protein.
Sequence
MNGTANPLLDREEHCLRLGESFEKRPRASFHTIRYDFKPASIDTSCEGELQVGKGDEVTITLPHIPGSTPPMTVFKGNKRPYQKDCVLIINHDTGEFVLEKLSSSIQVKKTRAEGSSKIQARMEQQPTRPPQTSQPPPPPPPMPFRAPTKPPVGPKTSPLKDNPSPEPQLDDIKRELRAEVDIIEQMSSSSGSSSSDSESSSGSDDDSSSSGGEDNGPASPPQPSHQQPYNSRPAVANGTSRPQGSNQLMNALRNDLQLSESGSDSDD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of EAF1 expression in transfected 293T cell line (H00085403-T01) by EAF1 MaxPab polyclonal antibody.
Lane 1: EAF1 transfected lysate(29.48 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to EAF1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]Immunofluorescence
Immunofluorescence of purified MaxPab antibody to EAF1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — EAF1
Entrez GeneID
85403GeneBank Accession#
BC041329.2Protein Accession#
AAH41329.1Gene Name
EAF1
Gene Alias
-
Gene Description
ELL associated factor 1
Omim ID
608315Gene Ontology
HyperlinkOther Designations
ELL (eleven nineteen lysine-rich leukemia gene)-associated factor 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com