RGS8 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human RGS8 partial ORF ( NP_203131.1, 1 a.a. - 80 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MWNTLTRSLSDHPVGKDPQAMRTGQRQNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDVLLS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
34.54
Interspecies Antigen Sequence
Mouse (96); Rat (98)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — RGS8
Entrez GeneID
85397GeneBank Accession#
NM_033345Protein Accession#
NP_203131.1Gene Name
RGS8
Gene Alias
MGC119067, MGC119068, MGC119069
Gene Description
regulator of G-protein signaling 8
Omim ID
607189Gene Ontology
HyperlinkGene Summary
This gene is a member of the regulator of G protein signaling (RGS) family and encodes a protein with a single RGS domain. Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. They accelerate transit through the cycle of GTP binding and hydrolysis to GDP, thereby terminating signal transduction, but paradoxically, also accelerate receptor-stimulated activation. [provided by RefSeq
Other Designations
OTTHUMP00000033156|regulator of G-protein signalling 8
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com