Product Browser

Last updated: 2017/4/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MYLK2 monoclonal antibody (M01), clone 2G1

  • Catalog # : H00085366-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant MYLK2.
  • Immunogen:
  • MYLK2 (NP_149109, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • KLLAKKPPSEASELTFEGVPMTHSPTDPRPAKAEEGKNILAESQKEVGEKTPGQAGQAKMQGDTSRGIEFQAVPSEKSEVGQALCLTAREEDCFQILDDC
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00085366-M01
    Western Blot detection against Immunogen (36.63 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of MYLK2 expression in transfected 293T cell line by MYLK2 monoclonal antibody (M01), clone 2G1.

    Lane 1: MYLK2 transfected lysate(64.7 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • Western blot analysis of MYLK2 over-expressed 293 cell line, cotransfected with MYLK2 Validated Chimera RNAi ( Cat # H00085366-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MYLK2 monoclonal antibody (M01), clone 2G1 (Cat # H00085366-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • enlarge
  • Gene Information
  • Gene Name:
  • MYLK2
  • Gene Alias:
  • KMLC,MLCK,MLCK2,skMLCK
  • Gene Description:
  • myosin light chain kinase 2
  • Gene Summary:
  • This gene encodes a myosin light chain kinase, a calcium/calmodulin dependent enzyme, that is exclusively expressed in adult skeletal muscle. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000030560,OTTHUMP00000030561,OTTHUMP00000030562,myosin light chain kinase 2, skeletal muscle,skeletal muscle myosin light chain kinase,skeletal myosin light chain kinase
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook