ALG2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
ALG2 MaxPab rabbit polyclonal antibody. Western Blot analysis of ALG2 expression in human kidney.
Western Blot (Cell lysate)
ALG2 MaxPab rabbit polyclonal antibody. Western Blot analysis of ALG2 expression in A-431.
Western Blot (Transfected lysate)
Western Blot analysis of ALG2 expression in transfected 293T cell line (H00085365-T01) by ALG2 MaxPab polyclonal antibody.
Lane 1: ALG2 transfected lysate(47.10 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human ALG2 protein.
Immunogen
ALG2 (NP_149078.1, 1 a.a. ~ 416 a.a) full-length human protein.
Sequence
MAEEQGRERDSVPKPSVLFLHPDLGVGGAERLVLDAALALQARGCSVKIWTAHYDPGHCFAESRELPVRCAGDWLPRGLGWGGRGAAVCAYVRMVFLALYVLFLADEEFDVVVCDQVSACIPVFRLARRRKKILFYCHFPDLLLTKRDSFLKRLYRAPIDWIEEYTTGMADCILVNSQFTAAVFKETFKSLSHIDPDVLYPSLNVTSFDSVVPEKLDDLVPKGKKFLLLSINRYERKKNLTLALEALVQLRGRLTSQDWERVHLIVAGGYDERVLENVEHYQELKKMVQQSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQCPVIAVNSGGPLESIDHSVTGFLCEPDPVHFSEAIEKFIREPSLKATMGLAGRARVKEKFSPEAFTEQLYRYVTKLLV
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (81); Rat (81)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ALG2 MaxPab rabbit polyclonal antibody. Western Blot analysis of ALG2 expression in human kidney.Western Blot (Cell lysate)
ALG2 MaxPab rabbit polyclonal antibody. Western Blot analysis of ALG2 expression in A-431.Western Blot (Transfected lysate)
Western Blot analysis of ALG2 expression in transfected 293T cell line (H00085365-T01) by ALG2 MaxPab polyclonal antibody.
Lane 1: ALG2 transfected lysate(47.10 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ALG2
Entrez GeneID
85365GeneBank Accession#
NM_033087.3Protein Accession#
NP_149078.1Gene Name
ALG2
Gene Alias
CDGIi, FLJ14511, hALPG2
Gene Description
asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog (S. cerevisiae)
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the glycosyltransferase 1 family. The encoded protein acts as an alpha 1,3 mannosyltransferase, mannosylating Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. Defects in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ii). Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
GDP-Man:Man(1)GlcNAc(2)-PP-dolichol mannosyltransferase|OTTHUMP00000021785|OTTHUMP00000123474|alpha-1,3-mannosyltransferase ALG2|asparagine-linked glycosylation 2 homolog (S. cerevisiae, alpha-1,3-mannosyltransferase)|asparagine-linked glycosylation 2 hom
-
Interactome
-
Pathway
-
Publication Reference
-
A microtubule-associated protein MAP1B binds to and regulates localization of a calcium-binding protein ALG-2.
Takahara T, Arai Y, Kono Y, Shibata H, Maki M.
Biochemical and Biophysical Research Communications 2018 Mar; 497:492.
Application：IF, WB-Ce, Human, HeLa, HEK293 cells.
-
A microtubule-associated protein MAP1B binds to and regulates localization of a calcium-binding protein ALG-2.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com