PPIL4 monoclonal antibody (M01), clone 1C10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PPIL4 monoclonal antibody (M01), clone 1C10 Western Blot analysis of PPIL4 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of PPIL4 expression in transfected 293T cell line by PPIL4 monoclonal antibody (M01), clone 1C10.
Lane 1: PPIL4 transfected lysate(57.2 KDa).
Lane 2: Non-transfected lysate.
RNAi Knockdown (Antibody validated)
Western blot analysis of PPIL4 over-expressed 293 cell line, cotransfected with PPIL4 Validated Chimera RNAi ( Cat # H00085313-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PPIL4 monoclonal antibody (M01), clone 1C10 (Cat # H00085313-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Immunofluorescence
Immunofluorescence of monoclonal antibody to PPIL4 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (33.66 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PPIL4.
Immunogen
PPIL4 (NP_624311, 395 a.a. ~ 466 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EKEDEDYMPIKNTNQDIYREMGFGHYEEEESCWEKQKSEKRDRTQNRSRSRSRERDGHYSNSHKSKYQTDLY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (45)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.66 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PPIL4 monoclonal antibody (M01), clone 1C10 Western Blot analysis of PPIL4 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of PPIL4 expression in transfected 293T cell line by PPIL4 monoclonal antibody (M01), clone 1C10.
Lane 1: PPIL4 transfected lysate(57.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of PPIL4 over-expressed 293 cell line, cotransfected with PPIL4 Validated Chimera RNAi ( Cat # H00085313-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PPIL4 monoclonal antibody (M01), clone 1C10 (Cat # H00085313-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to PPIL4 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PPIL4
Entrez GeneID
85313GeneBank Accession#
NM_139126Protein Accession#
NP_624311Gene Name
PPIL4
Gene Alias
HDCME13P
Gene Description
peptidylprolyl isomerase (cyclophilin)-like 4
Omim ID
607609Gene Ontology
HyperlinkGene Summary
This gene is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. [provided by RefSeq
Other Designations
OTTHUMP00000017393|OTTHUMP00000040123|PPIase|cyclophilin-type peptidyl-prolyl cis-trans isomerase|peptidylprolyl isomerase-like 4|serologically defined breast cancer antigen NY-BR-18
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com