Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPIL4 monoclonal antibody (M01), clone 1C10

  • Catalog # : H00085313-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant PPIL4.
  • Immunogen:
  • PPIL4 (NP_624311, 395 a.a. ~ 466 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • EKEDEDYMPIKNTNQDIYREMGFGHYEEEESCWEKQKSEKRDRTQNRSRSRSRERDGHYSNSHKSKYQTDLY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00085313-M01
    Western Blot detection against Immunogen (33.66 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PPIL4 monoclonal antibody (M01), clone 1C10 Western Blot analysis of PPIL4 expression in Hela S3 NE ( Cat # L013V3 ).
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PPIL4 expression in transfected 293T cell line by PPIL4 monoclonal antibody (M01), clone 1C10.

    Lane 1: PPIL4 transfected lysate(57.2 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • Western blot analysis of PPIL4 over-expressed 293 cell line, cotransfected with PPIL4 Validated Chimera RNAi ( Cat # H00085313-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PPIL4 monoclonal antibody (M01), clone 1C10 (Cat # H00085313-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • enlarge
  • Gene Information
  • Gene Name:
  • PPIL4
  • Gene Alias:
  • HDCME13P
  • Gene Description:
  • peptidylprolyl isomerase (cyclophilin)-like 4
  • Gene Summary:
  • This gene is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000017393,OTTHUMP00000040123,PPIase,cyclophilin-type peptidyl-prolyl cis-trans isomerase,peptidylprolyl isomerase-like 4,serologically defined breast cancer antigen NY-BR-18
  • RSS
  • YouTube
  • Linkedin
  • Facebook