Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PIGY (Human) Recombinant Protein (P02)

  • Catalog # : H00084992-P02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PIGY full-length ORF (NP_001036081.1, 1 a.a. - 71 a.a.) recombinant protein with GST tag at N-terminal.
  • Sequence:
  • MFLSLPTLTVLIPLVSLAGLFYSASVEENFPQGCTSTASLCFYSLLLPITIPVYVFFHLWTWMGIKLFRHN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.21
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue

    QC Testing of H00084992-P02
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • PIGY
  • Gene Alias:
  • MGC14156,PIG-Y
  • Gene Description:
  • phosphatidylinositol glycan anchor biosynthesis, class Y
  • Gene Summary:
  • This gene encodes two proteins, one of which is part of the GPI-N-acetylglucosaminyltransferase (GIP-GnT) complex which initiates the biosynthesis of glycosylphosphatidylinositol (GPI). GPI is synthesized in the endoplasmic reticulum and serves as an anchor for many surface proteins. Proteins containing GPI anchors can have an important role in cell-cell interactions. Two open reading frames have been found in the single transcript that has been identified for this gene. The downstream open reading frame encodes the GPI-GnT complex protein while the upstream open reading frame encodes a protein with unknown function. [provided by RefSeq
  • Other Designations:
  • phosphatidylinositol N-acetylglucosaminyltransferase subunit Y,phosphatidylinositol glycan, class Y
  • RSS
  • YouTube
  • Linkedin
  • Facebook