PIGY (Human) Recombinant Protein (P02)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PIGY full-length ORF (NP_001036081.1, 1 a.a. - 71 a.a.) recombinant protein with GST tag at N-terminal.
Sequence
MFLSLPTLTVLIPLVSLAGLFYSASVEENFPQGCTSTASLCFYSLLLPITIPVYVFFHLWTWMGIKLFRHN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
34.21
Interspecies Antigen Sequence
Mouse (85); Rat (89)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PIGY
Entrez GeneID
84992GeneBank Accession#
NM_001042616.1Protein Accession#
NP_001036081.1Gene Name
PIGY
Gene Alias
MGC14156, PIG-Y
Gene Description
phosphatidylinositol glycan anchor biosynthesis, class Y
Omim ID
610662Gene Ontology
HyperlinkGene Summary
This gene encodes two proteins, one of which is part of the GPI-N-acetylglucosaminyltransferase (GIP-GnT) complex which initiates the biosynthesis of glycosylphosphatidylinositol (GPI). GPI is synthesized in the endoplasmic reticulum and serves as an anchor for many surface proteins. Proteins containing GPI anchors can have an important role in cell-cell interactions. Two open reading frames have been found in the single transcript that has been identified for this gene. The downstream open reading frame encodes the GPI-GnT complex protein while the upstream open reading frame encodes a protein with unknown function. [provided by RefSeq
Other Designations
phosphatidylinositol N-acetylglucosaminyltransferase subunit Y|phosphatidylinositol glycan, class Y
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com