Product Browser

Last updated: 2017/3/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RBM17 (Human) Recombinant Protein (Q01)

  • Catalog # : H00084991-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RBM17 partial ORF ( NP_116294.1, 302 a.a. - 401 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • CPTKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGAPDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAEQV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00084991-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • RBM17
  • Gene Alias:
  • MGC14439,SPF45
  • Gene Description:
  • RNA binding motif protein 17
  • Gene Summary:
  • This gene encodes an RNA binding protein. The encoded protein is part of the spliceosome complex and functions in the second catalytic step of mRNA splicing. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 9 and 15. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000019034,splicing factor (45kD),splicing factor 45kDa
  • RSS
  • YouTube
  • Linkedin
  • Facebook