PPP1R16A purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PPP1R16A MaxPab polyclonal antibody. Western Blot analysis of PPP1R16A expression in human pancreas.
Western Blot (Transfected lysate)
Western Blot analysis of PPP1R16A expression in transfected 293T cell line (H00084988-T01) by PPP1R16A MaxPab polyclonal antibody.
Lane 1: PPP1R16A transfected lysate(58.08 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PPP1R16A protein.
Immunogen
PPP1R16A (AAH07854.1, 1 a.a. ~ 528 a.a) full-length human protein.
Sequence
MAEHLELLAEMPMVGRMSTQERLKHAQKRRAQQVKMWAQAEKEAQGKKGPGERPRKEAASQGLLKQVLFPPSVVLLEAAARNDLEEVRQFLGSGVSPDLANEDGLTALHQCCIDDFREMVQQLLEAGANINACDSECWTPLHAAATCGHLHLVELLIASGANLLAVNTDGNMPYDLCDDEQTLDCLETAMADRGITQDSIEAARAVPELRMLDDIRSRLQAGADLHAPLDHGATLLHVAAANGFSEAAALLLEHRASLSAKDQDGWEPLHAAAYWGQVPLVELLVAHGADLNAKSLMDETPLDVCGDEEVRAKLLELKHKHDALLRAQSRQRSLLRRRTSSAGSRGKVVRRVSLTQRTDLYRKQHAQEAIVWQQPPPTSPEPPEDNDDRQTGAELRPPPPEEDNPEVVRPHNGRVGGSPVRHLYSKRLDRSVSYQLSPLDSTTPHTLVHDKAHHTLADLKRQRAAAKLQRPPPEGPESPETAEPGLPGDTVTPQPDCGFRAGGDPPLLKLTAPAVEAPVERRPCCLLM
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (83)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PPP1R16A MaxPab polyclonal antibody. Western Blot analysis of PPP1R16A expression in human pancreas.Western Blot (Transfected lysate)
Western Blot analysis of PPP1R16A expression in transfected 293T cell line (H00084988-T01) by PPP1R16A MaxPab polyclonal antibody.
Lane 1: PPP1R16A transfected lysate(58.08 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PPP1R16A
Entrez GeneID
84988GeneBank Accession#
BC007854.1Protein Accession#
AAH07854.1Gene Name
PPP1R16A
Gene Alias
MGC14333, MYPT3
Gene Description
protein phosphatase 1, regulatory (inhibitor) subunit 16A
Omim ID
609172Gene Ontology
HyperlinkGene Summary
O
Other Designations
likley ortholog of mouse myosin phosphatase targeting subunit 3
-
Interactome
-
Publication Reference
-
Molecular markers of endometrial carcinoma detected in uterine aspirates.
Colas E, Perez C, Cabrera S, Pedrola N, Monge M, Castellvi J, Eyzaguirre F, Gregorio J, Ruiz A, Llaurado M, Rigau M, Garcia M, Ertekin T, Montes M, Lopez-Lopez R, Carreras R, Xercavins J, Ortega A, Maes T, Rosell E, Doll A, Abal M, Reventos J, Gil-Moreno A.
International Journal of Cancer 2011 Nov; 129(10):2435.
Application：IHC-P, Human, Human endometrial carcinoma.
-
Molecular markers of endometrial carcinoma detected in uterine aspirates.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com