WDR73 monoclonal antibody (M06), clone 4A6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
WDR73 monoclonal antibody (M06), clone 4A6. Western Blot analysis of WDR73 expression in HeLa.
Western Blot (Transfected lysate)
Western Blot analysis of WDR73 expression in transfected 293T cell line by WDR73 monoclonal antibody (M06), clone 4A6.
Lane 1: WDR73 transfected lysate (Predicted MW: 41.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged WDR73 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (68.1 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant WDR73.
Immunogen
WDR73 (NP_116245.2, 1 a.a. ~ 378 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDPGDDWLVESLRLYQDFYAFDLSGATRVLEWIDDKGVFVAGYESLKKNEILHLKLPLRLSVKENKGLFPERDFKVRHGGFSDRSIFDLKHVPHTRLLVTSGLPGCYLQVWQVAEDSDVIKAVSTIAVHEKEESLWPRVAVFSTLAPGVLHGARLRSLQVVDLESRKTTYTSDVSDSEELSSLQVLDADTFAFCCASGRLGLVDTRQKWAPLENRSPGPGSGGERWCAEVGSWGQGPGPSIASLGSDGRLCLLDPRDLCHPVSSVQCPVSVPSPDPELLRVTWAPGLKNCLAISGFDGTVQVYDATSWDGTRSQDGTRSQVEPLFTHRGHIFLDGNGMDPAPLVTTHTWHPCRPRTLLSATNDASLHVWDWVDLCAPR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78); Rat (78)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (68.1 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
WDR73 monoclonal antibody (M06), clone 4A6. Western Blot analysis of WDR73 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of WDR73 expression in transfected 293T cell line by WDR73 monoclonal antibody (M06), clone 4A6.
Lane 1: WDR73 transfected lysate (Predicted MW: 41.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged WDR73 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — WDR73
Entrez GeneID
84942GeneBank Accession#
NM_032856.2Protein Accession#
NP_116245.2Gene Name
WDR73
Gene Alias
FLJ14888, HSPC264
Gene Description
WD repeat domain 73
Gene Ontology
HyperlinkOther Designations
FLJ00296 protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com