ZNRF1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ZNRF1 expression in transfected 293T cell line (H00084937-T01) by ZNRF1 MaxPab polyclonal antibody.
Lane1:ZNRF1 transfected lysate(24.97 KDa).
Lane2:Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human ZNRF1 protein.
Immunogen
ZNRF1 (NP_115644.1, 1 a.a. ~ 227 a.a) full-length human protein.
Sequence
MGGKQSTAARSRGPFPGVSTDDSAVPPPGGAPHFGHYRTGGGAMGLRSRSVSSVAGMGMDPSTAGGVPFGLYTPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTKDAGECVICLEELLQGDTIARLPCLCIYHKSCIDSWFEVNRSCPEHPAD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ZNRF1 expression in transfected 293T cell line (H00084937-T01) by ZNRF1 MaxPab polyclonal antibody.
Lane1:ZNRF1 transfected lysate(24.97 KDa).
Lane2:Non-transfected lysate.
-
Gene Info — ZNRF1
Entrez GeneID
84937GeneBank Accession#
NM_032268.3Protein Accession#
NP_115644.1Gene Name
ZNRF1
Gene Alias
DKFZp434E229, FLJ14846, MGC15430, NIN283
Gene Description
zinc and ring finger 1
Gene Ontology
HyperlinkGene Summary
In a study identifying genes in rat that are upregulated in response to nerve damage, a gene which is highly expressed in ganglia and in the central nervous system was found. The protein encoded by the rat gene contains both a zinc finger and a RING finger motif and is localized in the endosome/lysosome compartment, indicating that it may be involved in ubiquitin-mediated protein modification. The protein encoded by this human gene is highly similar in sequence to that encoded by the rat gene. [provided by RefSeq
Other Designations
nerve injury gene 283|zinc and ring finger protein 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com