Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AMID (Human) Recombinant Protein (Q02)

  • Catalog # : H00084883-Q02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human AMID partial ORF ( AAH06121, 1 a.a. - 339 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 62.92
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00084883-Q02
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • AIFM2
  • Gene Alias:
  • AMID,PRG3,RP11-367H5.2
  • Gene Description:
  • apoptosis-inducing factor, mitochondrion-associated, 2
  • Gene Summary:
  • The protein encoded by this gene has significant homology to NADH oxidoreductases and the apoptosis-inducing factor PDCD8/AIF. Overexpression of this gene has been shown to induce apoptosis. The expression of this gene is found to be induced by tumor suppressor protein p53 in colon caner cells. [provided by RefSeq
  • Other Designations:
  • 5430437E11Rik,OTTHUMP00000019739,OTTHUMP00000019740,apoptosis-inducing factor (AIF)-homologous mitochondrion-associated inducer of death,apoptosis-inducing factor (AIF)-like mitchondrion-associated inducer of death,apoptosis-inducing factor (AIF)-like mit
  • RSS
  • YouTube
  • Linkedin
  • Facebook