Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AIFM2 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00084883-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human AIFM2 protein.
  • Immunogen:
  • AIFM2 (NP_116186.1, 1 a.a. ~ 373 a.a) full-length human protein.
  • Sequence:
  • MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • AIFM2 MaxPab rabbit polyclonal antibody. Western Blot analysis of AIFM2 expression in mouse lung.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of AIFM2 expression in transfected 293T cell line (H00084883-T02) by AIFM2 MaxPab polyclonal antibody.

    Lane 1: AIFM2 transfected lysate(40.50 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of AIFM2 transfected lysate using anti-AIFM2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with AIFM2 purified MaxPab mouse polyclonal antibody (B01P) (H00084883-B01P).
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • AIFM2
  • Gene Alias:
  • AMID,PRG3,RP11-367H5.2
  • Gene Description:
  • apoptosis-inducing factor, mitochondrion-associated, 2
  • Gene Summary:
  • The protein encoded by this gene has significant homology to NADH oxidoreductases and the apoptosis-inducing factor PDCD8/AIF. Overexpression of this gene has been shown to induce apoptosis. The expression of this gene is found to be induced by tumor suppressor protein p53 in colon caner cells. [provided by RefSeq
  • Other Designations:
  • 5430437E11Rik,OTTHUMP00000019739,OTTHUMP00000019740,apoptosis-inducing factor (AIF)-homologous mitochondrion-associated inducer of death,apoptosis-inducing factor (AIF)-like mitchondrion-associated inducer of death,apoptosis-inducing factor (AIF)-like mit
  • RSS
  • YouTube
  • Linkedin
  • Facebook