Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RSPO3 (Human) Recombinant Protein (P01)

  • Catalog # : H00084870-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RSPO3 full-length ORF (BAG37424.1, 1 a.a. - 272 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MHLRLISWLFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 56.32
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • RSPO3
  • Gene Alias:
  • CRISTIN1,FLJ14440,PWTSR,THSD2
  • Gene Description:
  • R-spondin 3 homolog (Xenopus laevis)
  • Gene Summary:
  • This gene encodes a member of the thrombospondin type 1 repeat supergene family. In addition, the protein contains a furin-like cysteine-rich region. Furin-like repeat domains have been found in a variety of eukaryotic proteins involved in the mechanism of signal transduction by receptor tyrosine kinases. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000017161,R-spondin 3,thrombospondin, type I, domain containing 2,thrombospondin-like
  • RSS
  • YouTube
  • Linkedin
  • Facebook