PHF5A monoclonal antibody (M03), clone 2H7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PHF5A expression in transfected 293T cell line by PHF5A monoclonal antibody (M01), clone 2H7.
Lane 1: PHF5A transfected lysate(12.4 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PHF5A is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant PHF5A.
Immunogen
PHF5A (NP_116147, 1 a.a. ~ 110 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PHF5A expression in transfected 293T cell line by PHF5A monoclonal antibody (M01), clone 2H7.
Lane 1: PHF5A transfected lysate(12.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PHF5A is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — PHF5A
Entrez GeneID
84844GeneBank Accession#
NM_032758Protein Accession#
NP_116147Gene Name
PHF5A
Gene Alias
INI, MGC1346, SF3b14b, bK223H9.2
Gene Description
PHD finger protein 5A
Gene Ontology
HyperlinkGene Summary
This gene encodes a subunit of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence-independent manner and may anchor the U2 snRNP to the pre-mRNA. The protein encoded by this gene contains a PHD-finger-like domain that is flanked by highly basic N- and C-termini. This protein belongs to the PHD-finger superfamily and may act as a chromatin-associated protein. This gene has several pseudogenes on different chromosomes. [provided by RefSeq
Other Designations
PHD finger-like domain protein 5A|PHD-finger 5A|PHD-finger 5a|splicing factor 3B associated 14 kDa protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com