Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PLCD4 (Human) Recombinant Protein (Q01)

  • Catalog # : H00084812-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PLCD4 partial ORF ( AAH06355, 18 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHARQARGSAKPSFSISDVETIRNGHDSELLRSLAEELPLEQGFTIVFHGRRSNLDLMANSVEEAQIWMRGLQLLVDLVT
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00084812-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • PLCD4
  • Gene Alias:
  • MGC12837
  • Gene Description:
  • phospholipase C, delta 4
  • Gene Summary:
  • Phosphatidylinositol-specific phospholipase C (PLC) plays an important role in receptor-mediated signal transduction by generating 2 second messenger molecules, inositol 1,4,5-triphosphate (IP3) and diacylglycerol, from phosphatidylinositol 4,5-bisphosphate (PIP2). PLC comprises a diverse family of enzymes that differ in structure and tissue distribution (Berridge, 1993 [PubMed 8381210]).[supplied by OMIM
  • Other Designations:
  • PLC delta4
  • RSS
  • YouTube
  • Linkedin
  • Facebook