Product Browser

Last updated: 2016/12/11
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PCGF1 polyclonal antibody (A01)

  • Catalog # : H00084759-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PCGF1.
  • Immunogen:
  • PCGF1 (NP_116062, 105 a.a. ~ 187 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DSEEKRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00084759-A01
    Western Blot detection against Immunogen (35.24 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PCGF1 polyclonal antibody (A01), Lot # 051114JC01. Western Blot analysis of PCGF1 expression in Daoy.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • PCGF1
  • Gene Alias:
  • 2010002K04Rik,FLJ43754,MGC10882,NSPC1,RNF3A-2,RNF68
  • Gene Description:
  • polycomb group ring finger 1
  • Gene Summary:
  • PCGF1 is a mammalian homolog of the Drosophila polycomb group genes, which act as transcriptional repressors to regulate anterior-posterior patterning in early embryonic development (Nunes et al., 2001 [PubMed 11287196]). See also PCGF2 (MIM 600346).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000160412
  • RSS
  • YouTube
  • Linkedin
  • Facebook