GRCC9 monoclonal antibody (M01), clone 1E6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
GRCC9 monoclonal antibody (M01), clone 1E6 Western Blot analysis of SPSB2 expression in A-549 ( Cat # L025V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SPSB2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SPSB2 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.64 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GRCC9.
Immunogen
GRCC9 (AAH02983, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERRPVAQSTDGARGKRGYSRGLHA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GRCC9 monoclonal antibody (M01), clone 1E6 Western Blot analysis of SPSB2 expression in A-549 ( Cat # L025V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SPSB2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SPSB2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — SPSB2
Entrez GeneID
84727GeneBank Accession#
BC002983Protein Accession#
AAH02983Gene Name
SPSB2
Gene Alias
GRCC9, MGC2519, SSB-2, SSB2
Gene Description
splA/ryanodine receptor domain and SOCS box containing 2
Omim ID
611658Gene Ontology
HyperlinkGene Summary
This gene encodes encodes a suppressor of cytokine signaling (SOCS) family member, and it belongs to the subfamily of proteins containing a central SPRY (repeats in splA and RyR) domain and a C-terminal SOCS box. This gene is present in a gene-rich cluster on chromosome 12p13 in the vicinity of the CD4 antigen and triosephosphate isomerase genes. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
SPRY domain-containing SOCS box protein SSB-2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com