Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GRCC9 monoclonal antibody (M01), clone 1E6

  • Catalog # : H00084727-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant GRCC9.
  • Immunogen:
  • GRCC9 (AAH02983, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERRPVAQSTDGARGKRGYSRGLHA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00084727-M01
    Western Blot detection against Immunogen (35.64 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • GRCC9 monoclonal antibody (M01), clone 1E6 Western Blot analysis of SPSB2 expression in A-549 ( Cat # L025V1 ).
  • PDF DownloadProtocol Download
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlargeenlarge this image
  • Immunoperoxidase of monoclonal antibody to SPSB2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged SPSB2 is approximately 0.03ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • SPSB2
  • Gene Alias:
  • GRCC9,MGC2519,SSB-2,SSB2
  • Gene Description:
  • splA/ryanodine receptor domain and SOCS box containing 2
  • Gene Summary:
  • This gene encodes encodes a suppressor of cytokine signaling (SOCS) family member, and it belongs to the subfamily of proteins containing a central SPRY (repeats in splA and RyR) domain and a C-terminal SOCS box. This gene is present in a gene-rich cluster on chromosome 12p13 in the vicinity of the CD4 antigen and triosephosphate isomerase genes. Alternative splicing results in multiple transcript variants. [provided by RefSeq
  • Other Designations:
  • SPRY domain-containing SOCS box protein SSB-2
  • RSS
  • YouTube
  • Linkedin
  • Facebook