Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LNX1 polyclonal antibody (A01)

  • Catalog # : H00084708-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant LNX1.
  • Immunogen:
  • LNX1 (NP_116011, 19 a.a. ~ 118 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DNVGNLHFLYSELCKGAFHYGLTKDRKRRSQDGCPDGCASLTATAPSPEVSAAATISLMTDEPGLDNPAYVSSAEDGQPAISPVDSGRSNRTRARPFERS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00084708-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • LNX1
  • Gene Alias:
  • LNX,MPDZ,PDZRN2
  • Gene Description:
  • ligand of numb-protein X 1
  • Gene Summary:
  • This gene encodes a membrane-bound protein that is involved in signal transduction and protein interactions. The encoded product is an E3 ubiquitin-protein ligase, which mediates ubiquitination and subsequent proteasomal degradation of proteins containing phosphotyrosine binding (PTB) domains. This protein may play an important role in tumorogenesis. Alternatively spliced transcript variants encoding distinct isoforms have been described. A pseudogene, which is located on chromosome 17, has been identified for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000128294,PDZ domain-containing ring finger protein 2,multi-PDZ-domain-containing protein, E3 ubiquitin-protein ligase LNX
  • RSS
  • YouTube
  • Linkedin
  • Facebook