LOXL3 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (37.11 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant LOXL3.
Immunogen
LOXL3 (NP_115992, 171 a.a. ~ 270 a.a) partial recombinant protein with GST tag.
Sequence
IRPAVGWGRRPLPVTEGLVEVRLPDGWSQVCDKGWSAHNSHVVCGMLGFPSEKRVNAAFYRLLAQRQQHSFGLHGVACVGTEAHLSLCSLEFYRANDTAR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (90)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — LOXL3
Entrez GeneID
84695GeneBank Accession#
NM_032603Protein Accession#
NP_115992Gene Name
LOXL3
Gene Alias
LOXL
Gene Description
lysyl oxidase-like 3
Omim ID
607163Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. Alternatively spliced transcript variants of this gene have been reported but their full-length nature has not been determined. [provided by RefSeq
Other Designations
lysyl oxidase homolog 3
-
Interactome
-
Disease
-
Publication Reference
-
LOX family enzymes expression in vaginal tissue of premenopausal women with severe pelvic organ prolapse.
Alarab M, Bortolini MA, Drutz H, Lye S, Shynlova O.
International Urogynecology Journal 2010 Nov; 21(11):1397.
Application：IHC, Human, Human vaginal specimens.
-
LOX family enzymes expression in vaginal tissue of premenopausal women with severe pelvic organ prolapse.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com