Product Browser

Last updated: 2017/4/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPP1R9B (Human) Recombinant Protein (Q01)

  • Catalog # : H00084687-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PPP1R9B partial ORF ( NP_115984, 708 a.a. - 817 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • QLEQSVEENKERMEKLEGYWGEAQSLCQAVDEHLRETQAQYQALERKYSKAKRLIKDYQQKEIEFLKKETAQRRVLEESELARKEEMDKLLDKISELEGNLQTLRNSNST
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00084687-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • PPP1R9B
  • Gene Alias:
  • FLJ30345,PPP1R6,PPP1R9,SPINO,Spn
  • Gene Description:
  • protein phosphatase 1, regulatory (inhibitor) subunit 9B
  • Gene Summary:
  • Spinophilin is a regulatory subunit of protein phosphatase-1 catalytic subunit (PP1; see MIM 176875) and is highly enriched in dendritic spines, specialized protrusions from dendritic shafts that receive most of the excitatory input in the central nervous system (Allen et al., 1997 [PubMed 9275233]).[supplied by OMIM
  • Other Designations:
  • Neurabin-2,neurabin II,protein phosphatase 1, regulatory subunit 9B,protein phosphatase 1, regulatory subunit 9B, spinophilin,spinophilin
  • RSS
  • YouTube
  • Linkedin
  • Facebook