PPP1R9B polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (38.21 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant PPP1R9B.
Immunogen
PPP1R9B (NP_115984, 708 a.a. ~ 817 a.a) partial recombinant protein with GST tag.
Sequence
QLEQSVEENKERMEKLEGYWGEAQSLCQAVDEHLRETQAQYQALERKYSKAKRLIKDYQQKEIEFLKKETAQRRVLEESELARKEEMDKLLDKISELEGNLQTLRNSNST
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.21 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — PPP1R9B
Entrez GeneID
84687GeneBank Accession#
NM_032595Protein Accession#
NP_115984Gene Name
PPP1R9B
Gene Alias
FLJ30345, PPP1R6, PPP1R9, SPINO, Spn
Gene Description
protein phosphatase 1, regulatory (inhibitor) subunit 9B
Omim ID
603325Gene Ontology
HyperlinkGene Summary
Spinophilin is a regulatory subunit of protein phosphatase-1 catalytic subunit (PP1; see MIM 176875) and is highly enriched in dendritic spines, specialized protrusions from dendritic shafts that receive most of the excitatory input in the central nervous system (Allen et al., 1997 [PubMed 9275233]).[supplied by OMIM
Other Designations
Neurabin-2|neurabin II|protein phosphatase 1, regulatory subunit 9B|protein phosphatase 1, regulatory subunit 9B, spinophilin|spinophilin
-
Interactome
-
Disease
-
Publication Reference
-
SIPA1L1/SPAR1 interacts with the neurabin family of proteins and is involved in GPCR signaling.
Ken Matsuura, Shizuka Kobayashi, Kohtarou Konno, Miwako Yamasaki, Takahiro Horiuchi, Takao Senda, Tomoatsu Hayashi, Kiyotoshi Satoh, Fumiko Arima-Yoshida, Kei Iwasaki, Lumi Negishi, Naomi Yasui-Shimizu, Kazuyoshi Kohu, Shigenori Kawahara, Yutaka Kirino, Tsutomu Nakamura, Masahiko Watanabe, Tadashi Yamamoto, Toshiya Manabe and Tetsu Akiyama.
Journal of Neuroscience 2022 Mar; 42(12):2448.
Application：IF, Mouse, Mouse brain.
-
Asef2 and Neurabin2 cooperatively regulate actin cytoskeletal organization and are involved in HGF-induced cell migration.
Sagara M, Kawasaki Y, Iemura SI, Natsume T, Takai Y, Akiyama T.
Oncogene 2009 Mar; 28(10):1357.
Application：WB, IF, Human, HEK 293T, HeLa cells.
-
SIPA1L1/SPAR1 interacts with the neurabin family of proteins and is involved in GPCR signaling.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com