Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPP1R9B polyclonal antibody (A01)

  • Catalog # : H00084687-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PPP1R9B.
  • Immunogen:
  • PPP1R9B (NP_115984, 708 a.a. ~ 817 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • QLEQSVEENKERMEKLEGYWGEAQSLCQAVDEHLRETQAQYQALERKYSKAKRLIKDYQQKEIEFLKKETAQRRVLEESELARKEEMDKLLDKISELEGNLQTLRNSNST
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00084687-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • PPP1R9B
  • Gene Alias:
  • FLJ30345,PPP1R6,PPP1R9,SPINO,Spn
  • Gene Description:
  • protein phosphatase 1, regulatory (inhibitor) subunit 9B
  • Gene Summary:
  • Spinophilin is a regulatory subunit of protein phosphatase-1 catalytic subunit (PP1; see MIM 176875) and is highly enriched in dendritic spines, specialized protrusions from dendritic shafts that receive most of the excitatory input in the central nervous system (Allen et al., 1997 [PubMed 9275233]).[supplied by OMIM
  • Other Designations:
  • Neurabin-2,neurabin II,protein phosphatase 1, regulatory subunit 9B,protein phosphatase 1, regulatory subunit 9B, spinophilin,spinophilin
  • RSS
  • YouTube
  • Linkedin
  • Facebook