Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HINT2 polyclonal antibody (A01)

  • Catalog # : H00084681-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant HINT2.
  • Immunogen:
  • HINT2 (NP_115982, 60 a.a. ~ 163 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LDKSLPADILYEDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00084681-A01
    Western Blot detection against Immunogen (37.55 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • HINT2
  • Gene Alias:
  • HIT-17
  • Gene Description:
  • histidine triad nucleotide binding protein 2
  • Gene Summary:
  • Histidine triad proteins, such as HINT2, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides (Brenner, 2002 [PubMed 12119013]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000021363,PKCI-1-related HIT protein,protein kinase C inhibitor-2
  • RSS
  • YouTube
  • Linkedin
  • Facebook