Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DGAT2 monoclonal antibody (M03), clone 4C1

  • Catalog # : H00084649-M03
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant DGAT2.
  • Immunogen:
  • DGAT2 (NP_115953.2, 289 a.a. ~ 388 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • IFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • DGAT2 monoclonal antibody (M03), clone 4C1. Western Blot analysis of DGAT2 expression in human stomach.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • DGAT2 monoclonal antibody (M03), clone 4C1. Western Blot analysis of DGAT2 expression in MCF-7.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged DGAT2 is 0.3 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • DGAT2
  • Gene Alias:
  • DKFZp686A15125,HMFN1045
  • Gene Description:
  • diacylglycerol O-acyltransferase homolog 2 (mouse)
  • Gene Summary:
  • Acyl-CoA:diacylglycerol acyltransferase, or DGAT (EC 2.3.1.20), is responsible for the synthesis of triglycerides. It catalyzes a reaction in which diacylglycerol is covalently joined to long chain fatty acyl-CoAs.[supplied by OMIM
  • Other Designations:
  • GS1999full,diacylglycerol O-acyltransferase homolog 2,diacylglycerol O-acyltransferase-like protein 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook