NTNG2 monoclonal antibody (M01), clone 4F11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
NTNG2 monoclonal antibody (M01), clone 4F11 Western Blot analysis of NTNG2 expression in HeLa ( Cat # L013V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to NTNG2 on formalin-fixed paraffin-embedded human lung cancer. [antibody concentration 1.5 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NTNG2 is approximately 3ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NTNG2.
Immunogen
NTNG2 (NP_115925, 21 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGITCGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NTNG2 monoclonal antibody (M01), clone 4F11 Western Blot analysis of NTNG2 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to NTNG2 on formalin-fixed paraffin-embedded human lung cancer. [antibody concentration 1.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NTNG2 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — NTNG2
Entrez GeneID
84628GeneBank Accession#
NM_032536Protein Accession#
NP_115925Gene Name
NTNG2
Gene Alias
KIAA0625, KIAA1857, LHLL9381, Lmnt2, MGC21884, NTNG1, bA479K20.1
Gene Description
netrin G2
Gene Ontology
HyperlinkOther Designations
Netrin-G2|OTTHUMP00000022430|bA479K20.1 (novel protein)|laminet 2|netrin G1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com