Product Browser

Last updated: 2017/8/13

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ACSS1 (Human) Recombinant Protein (P01)

  • Catalog # : H00084532-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ACSS1 full-length ORF (BAC03530.1, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MKLKCIFGFATKETSCYNVTNIGFKSPSDFWQSVHSTLPRELAPCLVFNTSPNLALFSAAFAFIVVKDSAGDSDVVVQELKSMVATKIAKYAVPDEILVVKRLPKTRSGKVMRRLLRKIITSEAQELGDTTTLEDPSIIAEILSVYQKCKDKQAAAK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 43.7
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • ACSS1
  • Gene Alias:
  • ACAS2L,AceCS2L,FLJ45659,MGC33843
  • Gene Description:
  • acyl-CoA synthetase short-chain family member 1
  • Gene Summary:
  • An acetyl-CoA synthetase found in the mitochondrial matrix has been characterized in both cow and mouse. It is primarily a cardiac enzyme which produces acetyl-CoA mainly for the oxidation of acetate. The protein encoded by this gene is structurally similar to the cow and mouse proteins and therefore may serve a similar function in humans. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000030466,OTTHUMP00000030470,OTTHUMP00000030471,OTTHUMP00000030472,acetyl-Coenzyme A synthetase 2 (AMP forming)-like
  • RSS
  • YouTube
  • Linkedin
  • Facebook