RHOXF2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
RHOXF2 MaxPab polyclonal antibody. Western Blot analysis of RHOXF2 expression in NIH/3T3.
Western Blot (Cell lysate)
RHOXF2 MaxPab polyclonal antibody. Western Blot analysis of RHOXF2 expression in Raw 264.7.
Western Blot (Cell lysate)
RHOXF2 MaxPab polyclonal antibody. Western Blot analysis of RHOXF2 expression in PC-12.
Western Blot (Cell lysate)
PEPP-2 MaxPab polyclonal antibody. Western Blot analysis of PEPP-2 expression in K-562.
Western Blot (Transfected lysate)
Western Blot analysis of RHOXF2 expression in transfected 293T cell line (H00084528-T01) by RHOXF2 MaxPab polyclonal antibody.
Lane 1: PEPP-2 transfected lysate(31.79 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to PEPP-2 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human RHOXF2 protein.
Immunogen
RHOXF2 (AAH21719, 1 a.a. ~ 288 a.a) full-length human protein.
Sequence
MEPPDQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEVKEEEEDAQPEPEQGTAAGEKLKSAGAQGGEEKDGGGEEKDGGGAGVPGHLWEGDLEGTSGSDGNVEDSDQSEKEPGQQYSRPRGAVGGLEPGNAQQPNVHAFTPLQLQELERIFQREQFPSEFLRRRLARSMNVTELAVQIWFENRRAKWRRHQRALMARNMLPFMAVGQPVMVTAAEAITAPLFISGMRDDYFWDHSHSSSLCFPMPPFPPPSLPLPLMLLPPMPPAGQAEFGPFPFVIVPSFTFPNV
Host
Mouse
Reactivity
Human, Mouse, Rat
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RHOXF2 MaxPab polyclonal antibody. Western Blot analysis of RHOXF2 expression in NIH/3T3.Western Blot (Cell lysate)
RHOXF2 MaxPab polyclonal antibody. Western Blot analysis of RHOXF2 expression in Raw 264.7.Western Blot (Cell lysate)
RHOXF2 MaxPab polyclonal antibody. Western Blot analysis of RHOXF2 expression in PC-12.Western Blot (Cell lysate)
PEPP-2 MaxPab polyclonal antibody. Western Blot analysis of PEPP-2 expression in K-562.Western Blot (Transfected lysate)
Western Blot analysis of RHOXF2 expression in transfected 293T cell line (H00084528-T01) by RHOXF2 MaxPab polyclonal antibody.
Lane 1: PEPP-2 transfected lysate(31.79 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to PEPP-2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — RHOXF2
Entrez GeneID
84528GeneBank Accession#
BC021719Protein Accession#
AAH21719Gene Name
RHOXF2
Gene Alias
PEPP-2, PEPP2, THG1
Gene Description
Rhox homeobox family, member 2
Omim ID
300447Gene Ontology
HyperlinkGene Summary
O
Other Designations
OTTHUMP00000023933|PEPP subfamily gene 2|homeobox protein from AL590526
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com