HOP (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human HOP full-length ORF ( AAH14225, 1 a.a. - 73 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVID
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
33.77
Interspecies Antigen Sequence
Mouse (90); Rat (90)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — HOPX
Entrez GeneID
84525GeneBank Accession#
BC014225Protein Accession#
AAH14225Gene Name
HOPX
Gene Alias
Cameo, HOP, LAGY, MGC20820, NECC1, OB1, SMAP31, Toto
Gene Description
HOP homeobox
Omim ID
607275Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a homeodomain protein that lacks certain conserved residues required for DNA binding. It was reported that choriocarcinoma cell lines and tissues failed to express this gene, which suggested the possible involvement of this gene in malignant conversion of placental trophoblasts. Studies in mice suggest that this protein may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development. Multiple alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000158970|heart odd homeobox 1 protein|homeodomain-only protein|lung cancer-associated Y protein|not expressed in choriocarcinoma clone 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com