Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HOP (Human) Recombinant Protein (P01)

  • Catalog # : H00084525-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HOP full-length ORF ( AAH14225, 1 a.a. - 73 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVID
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 33.77
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00084525-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • HOPX
  • Gene Alias:
  • Cameo,HOP,LAGY,MGC20820,NECC1,OB1,SMAP31,Toto
  • Gene Description:
  • HOP homeobox
  • Gene Summary:
  • The protein encoded by this gene is a homeodomain protein that lacks certain conserved residues required for DNA binding. It was reported that choriocarcinoma cell lines and tissues failed to express this gene, which suggested the possible involvement of this gene in malignant conversion of placental trophoblasts. Studies in mice suggest that this protein may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development. Multiple alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000158970,heart odd homeobox 1 protein,homeodomain-only protein,lung cancer-associated Y protein,not expressed in choriocarcinoma clone 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook