Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DCTN5 (Human) Recombinant Protein (P01)

  • Catalog # : H00084516-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DCTN5 full-length ORF ( ADZ15660.1, 1 a.a. - 182 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 20.1
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • DCTN5
  • Gene Alias:
  • MGC3248,p25
  • Gene Description:
  • dynactin 5 (p25)
  • Gene Summary:
  • Dynactin (see MIM 601143) is a multimeric protein essential for minus-end-directed transport driven by the microtubule-based motor dynein (see DYNC1H1; MIM 600112). DCTN5 is a subunit of the pointed-end subcomplex of dynactin that is thought to interact with membranous cargo (Parisi et al., 2004 [PubMed 15043994]).[supplied by OMIM
  • Other Designations:
  • dynactin 4,dynactin 5
  • RSS
  • YouTube
  • Linkedin
  • Facebook