SYVN1 monoclonal antibody (M01), clone 4H4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SYVN1 expression in transfected 293T cell line by SYVN1 monoclonal antibody (M01), clone 4H4.
Lane 1: SYVN1 transfected lysate(67.685 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SYVN1 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (34.65 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SYVN1.
Immunogen
SYVN1 (NP_079434, 238 a.a. ~ 318 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HTFPLFAIRPMYLAMRQFKKAVTDAIMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVTGAKRLPCNHIFHTSCLRS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.65 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SYVN1 expression in transfected 293T cell line by SYVN1 monoclonal antibody (M01), clone 4H4.
Lane 1: SYVN1 transfected lysate(67.685 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SYVN1 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — SYVN1
Entrez GeneID
84447GeneBank Accession#
NM_032431Protein Accession#
NP_079434Gene Name
SYVN1
Gene Alias
HRD1, KIAA1810, MGC40372
Gene Description
synovial apoptosis inhibitor 1, synoviolin
Omim ID
608046Gene Ontology
HyperlinkGene Summary
This gene encodes a protein involved in endoplasmic reticulum (ER)-associated degradation. The encoded protein removes unfolded proteins, accumulated during ER stress, by retrograde transport to the cytosol from the ER. This protein also uses the ubiquitin-proteasome system for additional degradation of unfolded proteins. This gene and the mitochondrial ribosomal protein L49 gene use in their respective 3' UTRs some of the same genomic sequence. Sequence analysis identified two transcript variants that encode different isoforms. [provided by RefSeq
Other Designations
synoviolin 1
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com