MKI67IP purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
MKI67IP MaxPab polyclonal antibody. Western Blot analysis of MKI67IP expression in human kidney.
Western Blot (Transfected lysate)
Western Blot analysis of MKI67IP expression in transfected 293T cell line (H00084365-T01) by MKI67IP MaxPab polyclonal antibody.
Lane 1: MKI67IP transfected lysate(32.23 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to MKI67IP on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human MKI67IP protein.
Immunogen
MKI67IP (NP_115766.2, 1 a.a. ~ 293 a.a) full-length human protein.
Sequence
MATFSGPAGPILSLNPQEDVEFQKEVAQVRKRITQRKKQEQLTPGVVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYAFVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQPSYQSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEIVFKQPISCVKEEIQETQTPTHSRKKRRRSSNQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (56); Rat (59)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
MKI67IP MaxPab polyclonal antibody. Western Blot analysis of MKI67IP expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of MKI67IP expression in transfected 293T cell line (H00084365-T01) by MKI67IP MaxPab polyclonal antibody.
Lane 1: MKI67IP transfected lysate(32.23 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to MKI67IP on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — MKI67IP
Entrez GeneID
84365GeneBank Accession#
NM_032390.3Protein Accession#
NP_115766.2Gene Name
MKI67IP
Gene Alias
NIFK, Nopp34
Gene Description
MKI67 (FHA domain) interacting nucleolar phosphoprotein
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that interacts with the forkhead-associated domain of the Ki-67 antigen. The encoded protein may bind RNA and may play a role in mitosis and cell cycle progression. Multiple pseudogenes exist on chromosomes 5, 10, 12, 15, and 19.[provided by RefSeq
Other Designations
nucleolar phosphoprotein Nopp34|nucleolar protein interacting with the FHA domain of pKi-67
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com