THOC3 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
THOC3 MaxPab polyclonal antibody. Western Blot analysis of THOC3 expression in NIH/3T3.
Western Blot (Cell lysate)
THOC3 MaxPab polyclonal antibody. Western Blot analysis of THOC3 expression in IMR-32.
Western Blot (Cell lysate)
THOC3 MaxPab polyclonal antibody. Western Blot analysis of THOC3 expression in Raw 264.7.
Western Blot (Cell lysate)
THOC3 MaxPab polyclonal antibody. Western Blot analysis of THOC3 expression in PC-12.
Western Blot (Transfected lysate)
Western Blot analysis of THOC3 expression in transfected 293T cell line (H00084321-T01) by THOC3 MaxPab polyclonal antibody.
Lane 1: THOC3 transfected lysate(38.61 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to THOC3 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human THOC3 protein.
Immunogen
THOC3 (AAH06849, 1 a.a. ~ 351 a.a) full-length human protein.
Sequence
MAVPAAAMGPSALGQSGPGSMAPWCSVSSGPSRYVLGMQELFRGHSKTREFLAHSAKVHSVAWSCDGRRLASGSFDKTASVFLLEKDRLVKENNYRGHGDSVDQLCWHPSNPDLFVTASGDKTIRIWDVRTTKCIATVNTKGENINICWSPDGQTIAVGNKDDVVTFIDAKTHRSKAEEQFKFEVNEISWNNDNNMFFLTNGNGCINILSYPELKPVQSINAHPSNCICIKFDPMGKYFATGSADALVSLWDVDELVCVRCFSRLDWPVRTLSFSHDGKMLASASEDHFIDIAEVETGDKLWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLPNDS
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
THOC3 MaxPab polyclonal antibody. Western Blot analysis of THOC3 expression in NIH/3T3.Western Blot (Cell lysate)
THOC3 MaxPab polyclonal antibody. Western Blot analysis of THOC3 expression in IMR-32.Western Blot (Cell lysate)
THOC3 MaxPab polyclonal antibody. Western Blot analysis of THOC3 expression in Raw 264.7.Western Blot (Cell lysate)
THOC3 MaxPab polyclonal antibody. Western Blot analysis of THOC3 expression in PC-12.Western Blot (Transfected lysate)
Western Blot analysis of THOC3 expression in transfected 293T cell line (H00084321-T01) by THOC3 MaxPab polyclonal antibody.
Lane 1: THOC3 transfected lysate(38.61 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to THOC3 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — THOC3
Entrez GeneID
84321GeneBank Accession#
BC006849Protein Accession#
AAH06849Gene Name
THOC3
Gene Alias
MGC5469, TEX1
Gene Description
THO complex 3
Omim ID
606929Gene Ontology
HyperlinkGene Summary
TEX1 is part of the TREX (transcription/export) complex, which includes THO2 (MIM 300395), HPR1 (MIM 606930), ALY (MIM 604171), and UAP56 (MIM 606390).[supplied by OMIM
Other Designations
-
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com