C17orf37 monoclonal antibody (M02), clone 3B5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant C17orf37.
Immunogen
C17orf37 (NP_115715.3, 1 a.a. ~ 115 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.8 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of C17orf37 expression in transfected 293T cell line by C17orf37 monoclonal antibody (M02), clone 3B5.
Lane 1: C17orf37 transfected lysate(12.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged C17orf37 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — C17orf37
Entrez GeneID
84299GeneBank Accession#
NM_032339.3Protein Accession#
NP_115715.3Gene Name
C17orf37
Gene Alias
C35, MGC14832, ORB3, RDX12, XTP4
Gene Description
chromosome 17 open reading frame 37
Gene Ontology
HyperlinkOther Designations
hypothetical protein LOC84299
-
Interactome
-
Disease
-
Publication Reference
-
Short Peptides based on the conserved regions of MIEN1 protein exhibit anti-cancer activity by targeting the MIEN1 Signaling Pathway.
Amit K Tripathi, Priyanka P Desai, Antariksh Tyagi, Jana B Lampe, Yogesh Srivastava, Michael Donkor, Harlan P Jones, Sergei V Dzyuba, Eric Crossley, Noelle S Williams, Jamboor K Vishwanatha.
The Journal of Biological Chemistry 2024 Jan; 300(3):105680.
Application:WB, Human, MDA-MB-231, DU-145 cells.
-
CRISPR deletion of MIEN1 in breast cancer cells.
Van Treuren T, Vishwanatha JK.
PLoS One 2018 Oct; 13(10):e0204976.
Application:WB, Human, MDA-MB-231 cells.
-
MicroRNA-940 suppresses prostate cancer migration and invasion by regulating MIEN1.
Rajendiran S, Parwani AV, Hare RJ, Dasgupta S, Roby RK, Vishwanatha JK.
Molecular Cancer 2014 Nov; 13(1):250.
Application:WB, Human, DU-145, PWR-1E cells.
-
Short Peptides based on the conserved regions of MIEN1 protein exhibit anti-cancer activity by targeting the MIEN1 Signaling Pathway.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com