RNF135 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
RNF135 MaxPab rabbit polyclonal antibody. Western Blot analysis of RNF135 expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of RNF135 expression in transfected 293T cell line (H00084282-T02) by RNF135 MaxPab polyclonal antibody.
Lane 1: RNF135 transfected lysate(22.90 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human RNF135 protein.
Immunogen
RNF135 (NP_922921.1, 1 a.a. ~ 210 a.a) full-length human protein.
Sequence
MAGLGLGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARDARRWACPTCRQGAAQQPHLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSSLSSAAARPRRRPELQRVAVEKSITEVAQELTELVEHLVDIVRSLQNQRPLSESGPDNELSILGKENSWKPRLPPHAHCLTRATLHSGELLGLLSGPSIQPLT
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (56); Rat (54)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
RNF135 MaxPab rabbit polyclonal antibody. Western Blot analysis of RNF135 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of RNF135 expression in transfected 293T cell line (H00084282-T02) by RNF135 MaxPab polyclonal antibody.
Lane 1: RNF135 transfected lysate(22.90 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — RNF135
Entrez GeneID
84282GeneBank Accession#
NM_197939.1Protein Accession#
NP_922921.1Gene Name
RNF135
Gene Alias
L13, MGC13061, Riplet
Gene Description
ring finger protein 135
Omim ID
611358Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. This gene is located in a chromosomal region known to be frequently deleted in patients with neurofibromatosis. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com