HSDL2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human HSDL2 protein.
Immunogen
HSDL2 (NP_115679, 1 a.a. ~ 418 a.a) full-length human protein.
Sequence
MLPNTGRLAGCTVFITGASRGIGKAIALKAAKDGANIVIAAKTAQPHPKLLGTIYTAAEEIEAVGGKALPCIVDVRDEQQISAAVEKAIKKFGGIDILVNNASAISLTNTLDTPTKRLDLMMNVNTRGTYLASKACIPYLKKSKVAHILNISPPLNLNPVWFKQHCAYTIAKYGMSMYVLGMAEEFKGEIAVNALWPKTAIHTAAMDMLGGPGIESQCRKVDIIADAAYSIFQKPKSFTGNFVIDENILKEEGIENFDVYAIKPGHPLQPDFFLDEYPEAVSKKVESTGAVPEFKEEKLQLQPKPRSGAVEETFRIVKDSLSDDVVKATQAIYLFELSGEDGGTWFLDLKSKGGNVGYGEPSDQADVVMSMTTDDFVKMFSGKLKPTMAFMSGKLKIKGNMALAIKLEKLMNQMNARL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (87)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
HSDL2 MaxPab polyclonal antibody. Western Blot analysis of HSDL2 expression in human liver.Western Blot (Cell lysate)
HSDL2 MaxPab polyclonal antibody. Western Blot analysis of HSDL2 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of HSDL2 expression in transfected 293T cell line (H00084263-T02) by HSDL2 MaxPab polyclonal antibody.
Lane 1: HSDL2 transfected lysate(45.98 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — HSDL2
Entrez GeneID
84263GeneBank Accession#
NM_032303Protein Accession#
NP_115679Gene Name
HSDL2
Gene Alias
C9orf99, FLJ25855, MGC10940, SDR13C1
Gene Description
hydroxysteroid dehydrogenase like 2
Gene Ontology
HyperlinkGene Summary
member 1
Other Designations
OTTHUMP00000021935|short chain dehydrogenase/reductase family 13C, member 1
-
Interactome
-
Disease
-
Publication Reference
-
The proteome of human liver peroxisomes: identification of five new peroxisomal constituents by a label-free quantitative proteomics survey.
Gronemeyer T, Wiese S, Ofman R, Bunse C, Pawlas M, Hayen H, Eisenacher M, Stephan C, Meyer HE, Waterham HR, Erdmann R, Wanders RJ, Warscheid B.
PLoS One. 2013 Feb; 8(2):e57395.
Application:WB, Human, Human liver.
-
The proteome of human liver peroxisomes: identification of five new peroxisomal constituents by a label-free quantitative proteomics survey.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com