Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FBXW9 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00084261-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human FBXW9 protein.
  • Immunogen:
  • FBXW9 (ENSP00000254324, 1 a.a. ~ 135 a.a) full-length human protein.
  • Sequence:
  • MTGTSSQAARTTPWWWWTAEPTASCSVCSWTPTCSACPTRNPSSGLVTTRACCTSSPTATAASSLSGPLMWATAFPSLGSSTPWEPCTPHPLTRPSGCTCPQTHQGPFAPEGMTMGSIGSVLRATWWWPALETCR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of FBXW9 expression in transfected 293T cell line (H00084261-T01) by FBXW9 MaxPab polyclonal antibody.

    Lane 1: FBXW9 transfected lysate(14.85 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • FBXW9
  • Gene Alias:
  • Fbw9,MGC10870
  • Gene Description:
  • F-box and WD repeat domain containing 9
  • Gene Summary:
  • Members of the F-box protein family, such as FBXW9, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603034), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM
  • Other Designations:
  • F-box and WD-40 domain protein 9,F-box and WD-40 repeat containing protein 9,OTTHUMP00000196470,specificity factor for SCF ubiquitin ligase
  • RSS
  • YouTube
  • Linkedin
  • Facebook