FBXW9 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of FBXW9 expression in transfected 293T cell line (H00084261-T01) by FBXW9 MaxPab polyclonal antibody.
Lane 1: FBXW9 transfected lysate(14.85 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human FBXW9 protein.
Immunogen
FBXW9 (ENSP00000254324, 1 a.a. ~ 135 a.a) full-length human protein.
Sequence
MTGTSSQAARTTPWWWWTAEPTASCSVCSWTPTCSACPTRNPSSGLVTTRACCTSSPTATAASSLSGPLMWATAFPSLGSSTPWEPCTPHPLTRPSGCTCPQTHQGPFAPEGMTMGSIGSVLRATWWWPALETCR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (31); Rat (27)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FBXW9 expression in transfected 293T cell line (H00084261-T01) by FBXW9 MaxPab polyclonal antibody.
Lane 1: FBXW9 transfected lysate(14.85 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — FBXW9
Entrez GeneID
84261GeneBank Accession#
NM_032301.1Protein Accession#
ENSP00000254324Gene Name
FBXW9
Gene Alias
Fbw9, MGC10870
Gene Description
F-box and WD repeat domain containing 9
Omim ID
609074Gene Ontology
HyperlinkGene Summary
Members of the F-box protein family, such as FBXW9, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603034), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM
Other Designations
F-box and WD-40 domain protein 9|F-box and WD-40 repeat containing protein 9|OTTHUMP00000196470|specificity factor for SCF ubiquitin ligase
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com