FLJ23356 monoclonal antibody (M03), clone 6F10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FLJ23356.
Immunogen
FLJ23356 (NP_115613, 251 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GDFVAPEQLWPYGEDVPFHDDLMPSYDEKIDIWKIPDISSFLLGHIEGSDMVRFHLFDIHKACKSQTPSERPTAQDVLETYQKVLDTLRDAMMSQAREML
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (81); Rat (79)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FLJ23356 monoclonal antibody (M03), clone 6F10. Western Blot analysis of FLJ23356 expression in HeLa(Cat # L013V1 ).Western Blot (Cell lysate)
FLJ23356 monoclonal antibody (M03), clone 6F10. Western Blot analysis of FLJ23356 expression in HepG2(Cat # L019V1 ).Western Blot (Transfected lysate)
Western Blot analysis of FLJ23356 expression in transfected 293T cell line by FLJ23356 monoclonal antibody (M03), clone 6F10.
Lane 1: FLJ23356 transfected lysate(38.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FLJ23356 is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of FLJ23356 over-expressed 293 cell line, cotransfected with FLJ23356 Validated Chimera RNAi ( Cat # H00084197-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with FLJ23356 monoclonal antibody (M03), clone 6F10 (Cat # H00084197-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to FLJ23356 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — SGK196
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com