LOXL4 monoclonal antibody (M01), clone 4H7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant LOXL4.
Immunogen
LOXL4 (NP_115587, 657 a.a. ~ 755 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ACANFGEQGVTVGCWDTYRHDIDCQWVDITDVGPGNYIFQVIVNPHYEVAESDFSNNMLQCRCKYDGHRVWLHNCHTGNSYPANAELSLEQEQRLRNNL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (85)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LOXL4 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — LOXL4
Entrez GeneID
84171GeneBank Accession#
NM_032211Protein Accession#
NP_115587Gene Name
LOXL4
Gene Alias
FLJ21889, LOXC
Gene Description
lysyl oxidase-like 4
Omim ID
607318Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. [provided by RefSeq
Other Designations
OTTHUMP00000020243|lysyl oxidase homolog 4|lysyl oxidase related C
-
Interactome
-
Disease
-
Publication Reference
-
Matrix stiffness-upregulated LOXL2 promotes fibronectin production, MMP9 and CXCL12 expression and BMDCs recruitment to assist pre-metastatic niche formation.
Wu S, Zheng Q, Xing X, Dong Y, Wang Y, You Y, Chen R, Hu C, Chen J, Gao D, Zhao Y, Wang Z, Xue T, Ren Z, Cui J.
Journal of Experimental & Clinical Cancer Research 2018 May; 37(1):99.
Application:WB-Ce, Human, MHCC97H, Hep3B cells.
-
Matrix stiffness-upregulated LOXL2 promotes fibronectin production, MMP9 and CXCL12 expression and BMDCs recruitment to assist pre-metastatic niche formation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com