LOXL4 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant LOXL4.
Immunogen
LOXL4 (NP_115587, 657 a.a. ~ 755 a.a) partial recombinant protein with GST tag.
Sequence
ACANFGEQGVTVGCWDTYRHDIDCQWVDITDVGPGNYIFQVIVNPHYEVAESDFSNNMLQCRCKYDGHRVWLHNCHTGNSYPANAELSLEQEQRLRNNL
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (86); Rat (85)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
ELISA
-
Gene Info — LOXL4
Entrez GeneID
84171GeneBank Accession#
NM_032211Protein Accession#
NP_115587Gene Name
LOXL4
Gene Alias
FLJ21889, LOXC
Gene Description
lysyl oxidase-like 4
Omim ID
607318Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. [provided by RefSeq
Other Designations
OTTHUMP00000020243|lysyl oxidase homolog 4|lysyl oxidase related C
-
Interactome
-
Disease
-
Publication Reference
-
Alternatively spliced lysyl oxidase-like 4 isoforms have a pro-metastatic role in cancer.
Sebban S, Golan-Gerstl R, Karni R, Vaksman O, Davidson B, Reich R.
Clinical & Experimental Metastasis 2013 Jan; 30(1):103.
Application:IP, WB, Human, ES-2 cells.
-
Lysyl oxidase-like 4 is alternatively spliced in an anatomic site-specific manner in tumors involving the serosal cavities.
Sebban S, Davidson B, Reich R.
Virchows Archiv 2009 Jan; 454(1):71.
Application:IP, WB-Ti, WB-Tr, Human, Human ovarian carcinoma.
-
Alternatively spliced lysyl oxidase-like 4 isoforms have a pro-metastatic role in cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com