ANTXR1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ANTXR1 partial ORF ( NP_115584.1, 201 a.a. - 305 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
VNDGFQALQGIIHSILKKSCIEILAAEPSTICAGESFQVVVRGNGFRHARNVDRVLCSFKINDSVTLNEKPFSVEDTYLLCPAPILKEVGMKAALQVSMNDGLSF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.29
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ANTXR1
Entrez GeneID
84168GeneBank Accession#
NM_032208Protein Accession#
NP_115584.1Gene Name
ANTXR1
Gene Alias
ATR, FLJ10601, FLJ11298, FLJ21776, TEM8
Gene Description
anthrax toxin receptor 1
Omim ID
606410Gene Ontology
HyperlinkGene Summary
This gene encodes a type I transmembrane protein and is a tumor-specific endothelial marker that has been implicated in colorectal cancer. The encoded protein has been shown to also be a docking protein or receptor for Bacillus anthracis toxin, the causative agent of the disease, anthrax. The binding of the protective antigen (PA) component, of the tripartite anthrax toxin, to this receptor protein mediates delivery of toxin components to the cytosol of cells. Once inside the cell, the other two components of anthrax toxin, edema factor (EF) and lethal factor (LF) disrupt normal cellular processes. Three alternatively spliced variants that encode different protein isoforms have been described. [provided by RefSeq
Other Designations
2310008J16Rik|2810405N18Rik|tumor endothelial marker 8
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com