ZIC4 (Human) Recombinant Protein (P02)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ZIC4 full-length ORF (BAC86605.1, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MESLSLLLHTLPMSPEEEGGRDGGVQERAPGALSARGKGVLDLRRRGKGFLKIFCSSFPENERRMGEGGKHLTGTRPTSTNVSALPPPGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDSATPSALVSPSSDCGHKSQVASSAAVAARTADLSE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
47.2
Interspecies Antigen Sequence
Mouse (83)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ZIC4
Entrez GeneID
84107GeneBank Accession#
AK126595.1Protein Accession#
BAC86605.1Gene Name
ZIC4
Gene Alias
FLJ42609, FLJ45833
Gene Description
Zic family member 4
Omim ID
608948Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated with X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 1, a related family member on chromosome 3. This gene encodes a protein of unknown function. [provided by RefSeq
Other Designations
zinc family member 4 protein HZIC4|zinc finger protein of the cerebellum 4
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com