FBXO30 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant FBXO30.
Immunogen
FBXO30 (NP_115521, 656 a.a. ~ 745 a.a) partial recombinant protein with GST tag.
Sequence
MVILQWGKRKYPEGNSSWQIKEKVWRFSTAFCSVNEWKFADILSMADHLKKCSYNVVEKREEAIPLPCMCVTRELTKEGRSLRSVLKPVL
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (87); Rat (87)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.01 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FBXO30 polyclonal antibody (A01), Lot # 051102JCO1 Western Blot analysis of FBXO30 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — FBXO30
Entrez GeneID
84085GeneBank Accession#
NM_032145Protein Accession#
NP_115521Gene Name
FBXO30
Gene Alias
FLJ41030, Fbx30, MGC21674
Gene Description
F-box protein 30
Omim ID
609101Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and it is upregulated in nasopharyngeal carcinoma. [provided by RefSeq
Other Designations
F-box domain protein|F-box only protein 30|F-box only protein, helicase, 18|OTTHUMP00000017362
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com