OBSCN polyclonal antibody (A02)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (37 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant OBSCN.
Immunogen
OBSCN (XP_290923, 1551 a.a. ~ 1649 a.a) partial recombinant protein with GST tag.
Sequence
KAGMGPYSSPSEQVLLGGPSHLASEEESQGRSAQPLPSTKTFAFQTQIQRGRFSVVRQCWEKASGRALAAKIIPYHPKDKTAVLREYEALKGLRHPHLA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (87)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — OBSCN
Entrez GeneID
84033GeneBank Accession#
XM_290923Protein Accession#
XP_290923Gene Name
OBSCN
Gene Alias
DKFZp666E245, FLJ14124, KIAA1556, KIAA1639, MGC120409, MGC120410, MGC120411, MGC120412, MGC138590, UNC89
Gene Description
obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF
Omim ID
608616Gene Ontology
HyperlinkGene Summary
The obscurin gene spans more than 150 kb, contains over 80 exons and encodes a protein of approximately 720 kDa. The encoded protein contains 68 Ig domains, 2 fibronectin domains, 1 calcium/calmodulin-binding domain, 1 RhoGEF domain with an associated PH domain, and 2 serine-threonine kinase domains. This protein belongs to the family of giant sacromeric signaling proteins that includes titin and nebulin, and may have a role in the organization of myofibrils during assembly and may mediate interactions between the sarcoplasmic reticulum and myofibrils. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
obscurin, myosin light chain kinase|obscurin-MLCK|obscurin-RhoGEF
-
Interactome
-
Disease
-
Publication Reference
-
The kinase domains of obscurin interact with intercellular adhesion proteins.
Hu LY, Kontrogianni-Konstantopoulos A.
The FASEB Journal 2013 May; 27(5):2001.
Application：WB, Mouse, Moue multiple tissues.
-
The kinase domains of obscurin interact with intercellular adhesion proteins.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com