Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KREMEN1 polyclonal antibody (A01)

  • Catalog # : H00083999-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant KREMEN1.
  • Immunogen:
  • KREMEN1 (NP_114434, 310 a.a. ~ 391 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • INQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGSNSWAPPMGAGSHRVE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • KREMEN1 polyclonal antibody (A01), Lot # 050914JC01 Western Blot analysis of KREMEN1 expression in Y-79 ( Cat # L042V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • KREMEN1
  • Gene Alias:
  • FLJ31863,KREMEM1,KREMEN,KRM1
  • Gene Description:
  • kringle containing transmembrane protein 1
  • Gene Summary:
  • This gene encodes a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. The encoded protein is a component of a membrane complex that modulates canonical WNT signaling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000028977,kringle-coding gene marking the eye and the nose,kringle-containing transmembrane protein 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook