TSSK1B monoclonal antibody (M01), clone 4F12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TSSK1B.
Immunogen
TSSK1B (AAH22515, 267 a.a. ~ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LSHCWMQPKARGSPSVAINKEGESSRGTEPLWTPEPGSDKKSATKLEPEGEAQPQAQPETKPEGTAMQMSRQSEILGFPSKPSTMETEEGPPQQPPETRAQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (63); Rat (65)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TSSK1B expression in transfected 293T cell line by TSSK1B monoclonal antibody (M01), clone 4F12.
Lane 1: TSSK1B transfected lysate(41.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TSSK1B is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — TSSK1B
Entrez GeneID
83942GeneBank Accession#
BC022515Protein Accession#
AAH22515Gene Name
TSSK1B
Gene Alias
FKSG81, SPOGA4, STK22D, TSSK1
Gene Description
testis-specific serine kinase 1B
Omim ID
610709Gene Ontology
HyperlinkGene Summary
TSSK1 belongs to a family of serine/threonine kinases highly expressed in testis (Hao et al., 2004 [PubMed 15044604]).[supplied by OMIM
Other Designations
OTTHUMP00000159055|serine/threonine kinase 22D (spermiogenesis associated)|serine/threonine kinase FKSG81|spermiogenesis associated 4|testis-specific serine kinase 1
-
Interactome
-
Publication Reference
-
Expression of Testis-specific Serine/Threonine Kinases during the Reproductive and Nonreproductive Seasons and Their Localization in Mature Spermatozoa of Tree Shrews (Tupaia belangeri).
Xia Tan, Xin Zhang, Xiang Li, Minghua Yang, Yahui Li.
Comparative Medicine 2023 Aug; 73(4):277.
Application:IHC-P, Tree shrew, Sperm.
-
Expression and Localization of Five Members of the Testis-Specific Serine Kinase (Tssk) Family in Mouse and Human Sperm and Testis.
Li Y, Sosnik J, Brassard L, Reese M, Spiridonov NA, Bates TC, Johnson GR, Anguita J, Visconti PE, Salicioni AM.
Molecular Human Reproduction 2011 Jan; 17(1):42.
Application:IF, WB-Ce, Human, Mouse, Sperm, Testes.
-
Expression of Testis-specific Serine/Threonine Kinases during the Reproductive and Nonreproductive Seasons and Their Localization in Mature Spermatozoa of Tree Shrews (Tupaia belangeri).
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com