INHBE (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human INHBE full-length ORF ( AAH05161, 21 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
GTGSVCPSCGGSKLAPQAERALVLELAKQQILDGLHLTSRPRITHPPPQAALTRALRRLQPGSVAPGNGEEVISFATVTDSTSAYSSLLTFHLSTPRSHHLYHARLWLHVLPTLPGTLCLRIFRWGPRRRRQGSRTLLAEHHITNLGWHTLTLPSSGLRGEKSGVLKLQLDCRPLEGNSTVTGQPRRLLDTAGHQQPFLELKIRANEPGAGRARRRTPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
62.04
Interspecies Antigen Sequence
Mouse (83); Rat (81)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — INHBE
Entrez GeneID
83729GeneBank Accession#
BC005161Protein Accession#
AAH05161Gene Name
INHBE
Gene Alias
MGC4638
Gene Description
inhibin, beta E
Gene Ontology
HyperlinkGene Summary
INHBE is a member of the activin beta family (see INHBA; MIM 147290) that plays a role in pancreatic exocrine cell growth and proliferation (Hashimoto et al., 2006 [PubMed 16426570]).[supplied by OMIM
Other Designations
activin beta E
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Multiancestry exome sequencing reveals INHBE mutations associated with favorable fat distribution and protection from diabetes.
Parsa Akbari, Olukayode A Sosina, Jonas Bovijn, Karl Landheer, Jonas B Nielsen, Minhee Kim, Senem Aykul, Tanima De, Mary E Haas, George Hindy, Nan Lin, Ian R Dinsmore, Jonathan Z Luo, Stefanie Hectors, Benjamin Geraghty, Mary Germino, Lampros Panagis, Prodromos Parasoglou, Johnathon R Walls, Gabor Halasz, Gurinder S Atwal; Regeneron Genetics Center, DiscovEHR Collaboration, Marcus Jones, Michelle G LeBlanc, Christopher D Still, David J Carey, Alice Giontella, Marju Orho-Melander, Jaime Berumen,
Nature Communications 2022 Aug; 13(1):4844.
Application：WB-Re, N/A, N/A.
-
Multiancestry exome sequencing reveals INHBE mutations associated with favorable fat distribution and protection from diabetes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com