Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DNCL2A (Human) Recombinant Protein (P01)

  • Catalog # : H00083658-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DNCL2A full-length ORF ( AAH02481, 22 a.a. - 96 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • VVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 33.99
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00083658-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • DYNLRB1
  • Gene Alias:
  • BITH,BLP,DNCL2A,DNLC2A,ROBLD1
  • Gene Description:
  • dynein, light chain, roadblock-type 1
  • Gene Summary:
  • This gene is a member of the roadblock dynein light chain family and encodes a cytoplasmic protein that is capable of binding intermediate chain proteins. Upregulation of this gene has been associated with hepatocellular carcinomas, suggesting that this gene may be involved in tumor progression. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000030691,ROBL/LC7-like 1,Roadblock-1,bithoraxoid-like protein,cytoplasmic dynein light chain 2A,dynein, cytoplasmic, light polypeptide 2A,dynein-associated protein HKM23,dynein-associated protein Km23,roadblock domain containing 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook