BCL2L12 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of BCL2L12 expression in transfected 293T cell line (H00083596-T01) by BCL2L12 MaxPab polyclonal antibody.
Lane 1: BCL2L12 transfected lysate(36.63 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human BCL2L12 protein.
Immunogen
BCL2L12 (NP_001035758.1, 1 a.a. ~ 333 a.a) full-length human protein.
Sequence
MGRPAGLFPPLCPFLGFRPEACWERHMQIERAPSVPPFLRWAGYRPGPVRRRGKVELIKFVRVQWRRPQVEWRRRRWGPGPGASMAGSEELGLREDTLRVLAAFLRRGEAAGSPVPTPPSPAQEEPTDFLSRLRRCLPCSLGRGAAPSESPRPCSLPIRPCYGLEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAILRRLVALLEEEAEVINQKLASDPALRSKLVRLSSDSFARLVELFCSRDDSSRPSRACPGPPPPSPEPLARLALAMELSRRVAGLGGTLAGLSVEHVHSFTPWIQAHGGWEGILAVSPVDLNLPLD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (83)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of BCL2L12 expression in transfected 293T cell line (H00083596-T01) by BCL2L12 MaxPab polyclonal antibody.
Lane 1: BCL2L12 transfected lysate(36.63 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — BCL2L12
Entrez GeneID
83596GeneBank Accession#
NM_001040668Protein Accession#
NP_001035758.1Gene Name
BCL2L12
Gene Alias
MGC120313, MGC120314, MGC120315
Gene Description
BCL2-like 12 (proline rich)
Omim ID
610837Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein contains a Bcl-2 homology domain 2 (BH2). The function of this gene has not yet been determined. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq
Other Designations
BCL2-like 12|Bcl-2 related proline-rich protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com